Last update: November 27, 2020
From this page, you can download lists that we have already compiled for various parameter sets (resolution, sequence identity, etc.). The current list of Pisces CulledPDB sets is shown below. You may request other lists by using our Protein Sequence Culling Server .
In the list below, the resolution and percent identity cutoffs are given in each filename. E.g., for cullpdb_pc20_res1.8_R0.25_d201125_chains5640, the percentage identity cutoff is 20%, the resolution cutoff is 1.8 angstroms, and the R-factor cutoff is 0.25. The list was generated on November 27, 2020. The number of chains in the list is 5640. Files with "inclNOTXRAY" include sequences from non-xray-derived structures (mostly NMR but also including electron diffraction, FTIR, fiber diffraction, etc.). Files with "inclCA" include sequences of structures that contain only backbone CA coordinates.
Each file gives the PDB entry (four-letter code), chain code ("0" if there is only one chain in the entry), the experimental method (XRAY, NMR, etc.) the number of residues in the chain, the resolution, the R-value, and free R-value (if available; otherwise NA). The directory includes fasta sequence files for each list.
Culled PDB FTP directory
Gzipped file with all the lists Cull_d201125.tar.gz
Run Pisces locally in a standalone mode Pisces.tar.gz
PDBAA related database files for Pisces. If you have downloaded Pisces.tar.gz before, you only need to download this to get updated. You should put all unpacked files into Pisces/BLASTDB to finish the updating BLASTDB.tar.gz
BLAST searchable database files of pdbaa MolIDE's usage pdbaa.tar.gz
Three gzipped FASTA-format files of all PDB sequences are also available:
>1A01B 146 XRAY 1.80 0.169 0.223 HEMOGLOBIN (BETA CHAIN)
MHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPATQRFFESFGDLST
PDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDP
ENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
>1A01D 146 XRAY 1.80 0.169 0.223 HEMOGLOBIN (BETA CHAIN)
MHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPATQRFFESFGDLST
PDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDP
ENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
>1A01B 146 XRAY 1.80 0.169 0.223 HEMOGLOBIN (BETA CHAIN) || 1A01D
>1A01B 146 XRAY 1.80 0.169 0.223 HEMOGLOBIN (BETA CHAIN) || 1A01D 1A0WB 1A0WD
Qifang Xu (qifang.xu@fccc.edu)
Roland Dunbrack Jr. (roland.dunbrack@fccc.edu)
Developed by Guoli Wang, Qifang Xu & Roland L. Dunbrack, Jr.